| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries) |
| Domain d3kcca2: 3kcc A:138-206 [212286] Other proteins in same PDB: d3kcca1, d3kccb1 automated match to d1i5za1 complexed with cmp; mutant |
PDB Entry: 3kcc (more details), 1.66 Å
SCOPe Domain Sequences for d3kcca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kcca2 a.4.5.0 (A:138-206) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvy
Timeline for d3kcca2: