![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein MAP kinase activated protein kinase 2, mapkap2 [82789] (1 species) CaMK group; MAPKAPK subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82790] (16 PDB entries) |
![]() | Domain d3kc3i_: 3kc3 I: [212281] automated match to d1nxkc_ complexed with mk2 |
PDB Entry: 3kc3 (more details), 2.9 Å
SCOPe Domain Sequences for d3kc3i_:
Sequence, based on SEQRES records: (download)
>d3kc3i_ d.144.1.7 (I:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} qfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarre velhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereas eimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpc ytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqy efpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlke dkerwedvkeem
>d3kc3i_ d.144.1.7 (I:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} qfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarre velhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereas eimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettyvapevlgp ekydkscdmwslgvimyillcgyppfysnispgmktrirmgqyefpnpewsevseevkml irnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeem
Timeline for d3kc3i_: