Lineage for d1fgnl2 (1fgn L:109-214)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 220990Species Anti-human tissue factor Fab 5G9 (mouse), kappa L chain [49056] (2 PDB entries)
  8. 220992Domain d1fgnl2: 1fgn L:109-214 [21228]
    Other proteins in same PDB: d1fgnh1, d1fgnl1

Details for d1fgnl2

PDB Entry: 1fgn (more details), 2.5 Å

PDB Description: monoclonal murine antibody 5g9-anti-human tissue factor

SCOP Domain Sequences for d1fgnl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fgnl2 b.1.1.2 (L:109-214) Immunoglobulin (constant domains of L and H chains) {Anti-human tissue factor Fab 5G9 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1fgnl2:

Click to download the PDB-style file with coordinates for d1fgnl2.
(The format of our PDB-style files is described here.)

Timeline for d1fgnl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fgnl1