Lineage for d3kbba_ (3kbb A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490779Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2490780Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2491513Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2491514Protein automated matches [190447] (52 species)
    not a true protein
  7. 2491905Species Thermotoga maritima [TaxId:243274] [225784] (2 PDB entries)
  8. 2491908Domain d3kbba_: 3kbb A: [212272]
    automated match to d3s6je_
    complexed with gol, so4

Details for d3kbba_

PDB Entry: 3kbb (more details), 1.74 Å

PDB Description: crystal structure of putative beta-phosphoglucomutase from thermotoga maritima
PDB Compounds: (A:) Phosphorylated carbohydrates phosphatase TM_1254

SCOPe Domain Sequences for d3kbba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kbba_ c.108.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
meavifdmdgvlmdteplyfeayrrvaesygkpytedlhrrimgvpereglpilmealei
kdslenfkkrvheekkrvfsellkenpgvrealefvkskriklalatstpqrealerlrr
ldlekyfdvmvfgdqvkngkpdpeiyllvlerlnvvpekvvvfedsksgveaaksagier
iygvvhslndgkalleagavalvkpeeilnvlkevl

SCOPe Domain Coordinates for d3kbba_:

Click to download the PDB-style file with coordinates for d3kbba_.
(The format of our PDB-style files is described here.)

Timeline for d3kbba_: