![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
![]() | Protein automated matches [190891] (38 species) not a true protein |
![]() | Species Bacillus anthracis [TaxId:261594] [189450] (7 PDB entries) |
![]() | Domain d3kb8c1: 3kb8 C:1-179 [212270] Other proteins in same PDB: d3kb8a2, d3kb8b2, d3kb8c2, d3kb8d2 automated match to d1r3ub_ complexed with 5gp, gol, mg, po4 |
PDB Entry: 3kb8 (more details), 2.09 Å
SCOPe Domain Sequences for d3kb8c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kb8c1 c.61.1.0 (C:1-179) automated matches {Bacillus anthracis [TaxId: 261594]} mmnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtdtyl emdfmavssyghstvstgevkilkdldtsvegrdilivediidsgltlsylvdlfkyrka ksvkivtlldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsvys
Timeline for d3kb8c1: