Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Fab CTM01 (human construct), kappa L chain [49055] (1 PDB entry) |
Domain d1ad9b2: 1ad9 B:114-212 [21227] Other proteins in same PDB: d1ad9a1, d1ad9b1, d1ad9h1, d1ad9l1 |
PDB Entry: 1ad9 (more details), 2.8 Å
SCOP Domain Sequences for d1ad9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ad9b2 b.1.1.2 (B:114-212) Immunoglobulin (constant domains of L and H chains) {Fab CTM01 (human construct), kappa L chain} astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtktytcnvdhkpsntkvdkrve
Timeline for d1ad9b2: