Lineage for d3kasa2 (3kas A:190-382)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097883Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2098022Superfamily c.8.4: PA domain [52025] (1 family) (S)
  5. 2098023Family c.8.4.1: PA domain [52026] (2 protein domains)
  6. 2098053Protein Transferrin receptor ectodomain, apical domain [52027] (1 species)
  7. 2098054Species Human (Homo sapiens) [TaxId:9606] [52028] (4 PDB entries)
  8. 2098055Domain d3kasa2: 3kas A:190-382 [212266]
    Other proteins in same PDB: d3kasa1, d3kasa3
    automated match to d1de4c2
    complexed with k, nag, po4

Details for d3kasa2

PDB Entry: 3kas (more details), 2.4 Å

PDB Description: Machupo virus GP1 bound to human transferrin receptor 1
PDB Compounds: (A:) Transferrin receptor protein 1

SCOPe Domain Sequences for d3kasa2:

Sequence, based on SEQRES records: (download)

>d3kasa2 c.8.4.1 (A:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens) [TaxId: 9606]}
iqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkkdfedlytp
vngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffghahlgtgdpy
tpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktdstcrmvtse
sknvkltvsnvlk

Sequence, based on observed residues (ATOM records): (download)

>d3kasa2 c.8.4.1 (A:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens) [TaxId: 9606]}
iqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkkdfedlytp
vngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffghahlgtgdpy
tpgfpstqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktdstcrmvtseskn
vkltvsnvlk

SCOPe Domain Coordinates for d3kasa2:

Click to download the PDB-style file with coordinates for d3kasa2.
(The format of our PDB-style files is described here.)

Timeline for d3kasa2: