SCOPe 2.08: Domain d3kaha1: 3kah A:7-38

Lineage for d3kaha1 (3kah A:7-38)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.1: WW domain [51045] (2 families)

5. Family b.72.1.1: WW domain [51046] (13 proteins)

6. Protein Mitotic rotamase PIN1 [51047] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51048] (40 PDB entries)

8. Domain d3kaha1: 3kah A:7-38 [212260]
   Other proteins in same PDB: d3kaha2
   automated match to d2itka1
   complexed with 12p, 4dh

Details for d3kaha1

PDB Entry: 3kah, 2.3 Å

PDB Description: structure-guided design of alpha-amino acid-derived pin1 inhibitors

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d3kaha1:

Sequence; same for both SEQRES and ATOM records:

>d3kaha1 b.72.1.1 (A:7-38) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]}
lppgwekamsrssgrvyyfnhitnasqwerps

Timeline for d3kaha1:

• d3kaha1 first appeared in SCOPe 2.03
  
• d3kaha1 appears in SCOPe 2.07