SCOPe 2.08: Domain d3k9wa1: 3k9w A:1-161

Lineage for d3k9wa1 (3k9w A:1-161)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (61 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [189579] (3 PDB entries)

8. Domain d3k9wa1: 3k9w A:1-161 [212254]
   Other proteins in same PDB: d3k9wa2
   automated match to d3pxua_
   complexed with 4ps, act, ade, pg4, so4

Details for d3k9wa1

PDB Entry: 3k9w, 1.6 Å

PDB Description: crystal structure of phosphopantetheine adenylyltransferase from burkholderia pseudomallei with hydrolyzed 3'-dephospho coenzyme a

PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3k9wa1:

Sequence; same for both SEQRES and ATOM records:

>d3k9wa1 c.26.1.0 (A:1-161) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mvvavypgtfdpltrghedlvrrassifdtlvvgvadsrakkpffsleerlkianevlgh
ypnvkvmgftgllkdfvrandarvivrglravsdfeyefqmagmnryllpdvetmfmtps
dqyqfisgtivreiaqlggdvskfvfpsvekwltekvaama

Timeline for d3k9wa1:

• d3k9wa1 first appeared in SCOPe 2.03, called d3k9wa_
  
• d3k9wa1 appears in SCOPe 2.07