| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
| Protein Mn superoxide dismutase (MnSOD) [46618] (9 species) |
| Species Escherichia coli K-12 [TaxId:83333] [224842] (1 PDB entry) |
| Domain d3k9sd1: 3k9s D:1-90 [212250] Other proteins in same PDB: d3k9sa2, d3k9sb2, d3k9sc2, d3k9sd2 automated match to d1d5na1 complexed with mn, peo |
PDB Entry: 3k9s (more details), 1.55 Å
SCOPe Domain Sequences for d3k9sd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k9sd1 a.2.11.1 (D:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli K-12 [TaxId: 83333]}
sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk
Timeline for d3k9sd1: