![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88575] (63 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
![]() | Domain d1ad9h2: 1ad9 H:114-212 [21225] Other proteins in same PDB: d1ad9a1, d1ad9a2, d1ad9b1, d1ad9h1, d1ad9l1, d1ad9l2 |
PDB Entry: 1ad9 (more details), 2.8 Å
SCOP Domain Sequences for d1ad9h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ad9h2 b.1.1.2 (H:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)} astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtktytcnvdhkpsntkvdkrve
Timeline for d1ad9h2: