Lineage for d3k9sa2 (3k9s A:91-205)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946003Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2946129Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2946149Species Escherichia coli K-12 [TaxId:83333] [224926] (1 PDB entry)
  8. 2946150Domain d3k9sa2: 3k9s A:91-205 [212245]
    Other proteins in same PDB: d3k9sa1, d3k9sb1, d3k9sc1, d3k9sd1
    automated match to d1d5na2
    complexed with mn, peo

Details for d3k9sa2

PDB Entry: 3k9s (more details), 1.55 Å

PDB Description: Crystal structure of the peroxide-bound manganese superoxide dismutase.
PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d3k9sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k9sa2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli K-12 [TaxId: 83333]}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk

SCOPe Domain Coordinates for d3k9sa2:

Click to download the PDB-style file with coordinates for d3k9sa2.
(The format of our PDB-style files is described here.)

Timeline for d3k9sa2: