![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) |
![]() | Species Escherichia coli K-12 [TaxId:83333] [224926] (1 PDB entry) |
![]() | Domain d3k9sa2: 3k9s A:91-205 [212245] Other proteins in same PDB: d3k9sa1, d3k9sb1, d3k9sc1, d3k9sd1 automated match to d1d5na2 complexed with mn, peo |
PDB Entry: 3k9s (more details), 1.55 Å
SCOPe Domain Sequences for d3k9sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k9sa2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli K-12 [TaxId: 83333]} gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk
Timeline for d3k9sa2: