SCOPe 2.05: Domain d3k96b2: 3k96 B:181-327

Lineage for d3k96b2 (3k96 B:181-327)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (30 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:227377] [225777] (1 PDB entry)

8. Domain d3k96b2: 3k96 B:181-327 [212240]
   Other proteins in same PDB: d3k96a1, d3k96b1
   automated match to d1txga1
   complexed with bme, epe

Details for d3k96b2

PDB Entry: 3k96, 2.1 Å

PDB Description: 2.1 angstrom resolution crystal structure of glycerol-3-phosphate dehydrogenase (gpsa) from coxiella burnetii

PDB Compounds: (B:) glycerol-3-phosphate dehydrogenase [NAD(P)+]

SCOPe Domain Sequences for d3k96b2:

Sequence; same for both SEQRES and ATOM records:

>d3k96b2 a.100.1.0 (B:181-327) automated matches {Coxiella burnetii [TaxId: 227377]}
dmigvelcgsvknilaiatgisdglklgsnaraalitrgltemgrlvsvfggkqetltgl
aglgdlvltctdnqsrnrrfglalgegvdkkeaqqaigqaieglyntdqvhalaqkhaie
mpltfqvhrilhedldpqqavqeller

Timeline for d3k96b2:

• d3k96b2 first appeared in SCOPe 2.03
  
• d3k96b2 appears in SCOPe 2.04
  
• d3k96b2 appears in SCOPe 2.06
  
• d3k96b2 appears in the current release, SCOPe 2.08