Lineage for d3k96b2 (3k96 B:181-327)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721593Species Coxiella burnetii [TaxId:227377] [225777] (1 PDB entry)
  8. 2721595Domain d3k96b2: 3k96 B:181-327 [212240]
    Other proteins in same PDB: d3k96a1, d3k96b1
    automated match to d1txga1
    complexed with bme, epe

Details for d3k96b2

PDB Entry: 3k96 (more details), 2.1 Å

PDB Description: 2.1 angstrom resolution crystal structure of glycerol-3-phosphate dehydrogenase (gpsa) from coxiella burnetii
PDB Compounds: (B:) glycerol-3-phosphate dehydrogenase [NAD(P)+]

SCOPe Domain Sequences for d3k96b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k96b2 a.100.1.0 (B:181-327) automated matches {Coxiella burnetii [TaxId: 227377]}
dmigvelcgsvknilaiatgisdglklgsnaraalitrgltemgrlvsvfggkqetltgl
aglgdlvltctdnqsrnrrfglalgegvdkkeaqqaigqaieglyntdqvhalaqkhaie
mpltfqvhrilhedldpqqavqeller

SCOPe Domain Coordinates for d3k96b2:

Click to download the PDB-style file with coordinates for d3k96b2.
(The format of our PDB-style files is described here.)

Timeline for d3k96b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3k96b1