Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Coxiella burnetii [TaxId:227377] [225776] (1 PDB entry) |
Domain d3k96b1: 3k96 B:3-180 [212239] Other proteins in same PDB: d3k96a2, d3k96b2 automated match to d1txga2 complexed with bme, epe |
PDB Entry: 3k96 (more details), 2.1 Å
SCOPe Domain Sequences for d3k96b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k96b1 c.2.1.0 (B:3-180) automated matches {Coxiella burnetii [TaxId: 227377]} pfkhpiailgagswgtalalvlarkgqkvrlwsyesdhvdemqaegvnnrylpnypfpet lkaycdlkaslegvtdilivvpsfafhevitrmkplidaktriawgtkglakgsrllhev vatelgqvpmavisgpslatevaanlptavslasnnsqfskdlierlhgqrfrvyknd
Timeline for d3k96b1: