![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
![]() | Protein automated matches [226851] (46 species) not a true protein |
![]() | Species Coxiella burnetii [TaxId:227377] [225777] (1 PDB entry) |
![]() | Domain d3k96a2: 3k96 A:181-328 [212238] Other proteins in same PDB: d3k96a1, d3k96b1 automated match to d1txga1 complexed with bme, epe |
PDB Entry: 3k96 (more details), 2.1 Å
SCOPe Domain Sequences for d3k96a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k96a2 a.100.1.0 (A:181-328) automated matches {Coxiella burnetii [TaxId: 227377]} dmigvelcgsvknilaiatgisdglklgsnaraalitrgltemgrlvsvfggkqetltgl aglgdlvltctdnqsrnrrfglalgegvdkkeaqqaigqaieglyntdqvhalaqkhaie mpltfqvhrilhedldpqqavqellers
Timeline for d3k96a2: