Lineage for d3k96a1 (3k96 A:3-180)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107519Species Coxiella burnetii [TaxId:227377] [225776] (1 PDB entry)
  8. 2107520Domain d3k96a1: 3k96 A:3-180 [212237]
    Other proteins in same PDB: d3k96a2, d3k96b2
    automated match to d1txga2
    complexed with bme, epe

Details for d3k96a1

PDB Entry: 3k96 (more details), 2.1 Å

PDB Description: 2.1 angstrom resolution crystal structure of glycerol-3-phosphate dehydrogenase (gpsa) from coxiella burnetii
PDB Compounds: (A:) glycerol-3-phosphate dehydrogenase [NAD(P)+]

SCOPe Domain Sequences for d3k96a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k96a1 c.2.1.0 (A:3-180) automated matches {Coxiella burnetii [TaxId: 227377]}
pfkhpiailgagswgtalalvlarkgqkvrlwsyesdhvdemqaegvnnrylpnypfpet
lkaycdlkaslegvtdilivvpsfafhevitrmkplidaktriawgtkglakgsrllhev
vatelgqvpmavisgpslatevaanlptavslasnnsqfskdlierlhgqrfrvyknd

SCOPe Domain Coordinates for d3k96a1:

Click to download the PDB-style file with coordinates for d3k96a1.
(The format of our PDB-style files is described here.)

Timeline for d3k96a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3k96a2