Lineage for d3k92f2 (3k92 F:191-424)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830697Species Bacillus subtilis [TaxId:1423] [196388] (11 PDB entries)
  8. 1830730Domain d3k92f2: 3k92 F:191-424 [212236]
    Other proteins in same PDB: d3k92a1, d3k92b1, d3k92c1, d3k92d1, d3k92e1, d3k92f1
    automated match to d1v9la1
    complexed with peg; mutant

Details for d3k92f2

PDB Entry: 3k92 (more details), 2.3 Å

PDB Description: Crystal structure of a E93K mutant of the majour Bacillus subtilis glutamate dehydrogenase RocG
PDB Compounds: (F:) nad-specific glutamate dehydrogenase

SCOPe Domain Sequences for d3k92f2:

Sequence, based on SEQRES records: (download)

>d3k92f2 c.2.1.0 (F:191-424) automated matches {Bacillus subtilis [TaxId: 1423]}
ggsqgretataqgvticieeavkkkgiklqnariiiqgfgnagsflakfmhdagakvigi
sdangglynpdgldipylldkrdsfgmvtnlftdvitneellekdcdilvpaaisnqita
knahniqasivverangpttidatkilnergvllvpdilasaggvtvsyfewvqnnqgyy
wseeevaeklrsvmvssfetiyqtaathkvdmrlaaymtgirksaeasrfrgwv

Sequence, based on observed residues (ATOM records): (download)

>d3k92f2 c.2.1.0 (F:191-424) automated matches {Bacillus subtilis [TaxId: 1423]}
ggsqgretataqgvticieeavkkkgiklqnariiiqgfgnagsflakfmhdagakvigi
sdangglynpdgldipyllitneellekdcdilvpaaisnqitaknahniqasivveran
gpttidatkilnergvllvpdilasaggvtvsyfewvqnnqgyywseeevaeklrsvmvs
sfetiyqtaathkvdmrlaaymtgirksaeasrfrgwv

SCOPe Domain Coordinates for d3k92f2:

Click to download the PDB-style file with coordinates for d3k92f2.
(The format of our PDB-style files is described here.)

Timeline for d3k92f2: