Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
Protein automated matches [226864] (21 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [225904] (2 PDB entries) |
Domain d3k92d1: 3k92 D:16-190 [212231] Other proteins in same PDB: d3k92a2, d3k92b2, d3k92c2, d3k92d2, d3k92e2, d3k92f2 automated match to d1v9la2 complexed with peg; mutant |
PDB Entry: 3k92 (more details), 2.3 Å
SCOPe Domain Sequences for d3k92d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k92d1 c.58.1.0 (D:16-190) automated matches {Bacillus subtilis [TaxId: 1423]} nlflstqtiikealrklgypgdmyelmkepqrmltvripvkmdngsvkvftgyrsqhnda vgptkggvrfhpevneekvkalsiwmtlkcgianlpygggkggiicdprtmsfgelerls rgyvraisqivgptkdipapdvytnsqimawmmdeysrlrefdspgfitgkplvl
Timeline for d3k92d1: