Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [196388] (11 PDB entries) |
Domain d3k92c2: 3k92 C:191-424 [212230] Other proteins in same PDB: d3k92a1, d3k92b1, d3k92c1, d3k92d1, d3k92e1, d3k92f1 automated match to d1v9la1 complexed with peg; mutant |
PDB Entry: 3k92 (more details), 2.3 Å
SCOPe Domain Sequences for d3k92c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k92c2 c.2.1.0 (C:191-424) automated matches {Bacillus subtilis [TaxId: 1423]} ggsqgretataqgvticieeavkkkgiklqnariiiqgfgnagsflakfmhdagakvigi sdangglynpdgldipylldkrdsfgmvtnlftdvitneellekdcdilvpaaisnqita knahniqasivverangpttidatkilnergvllvpdilasaggvtvsyfewvqnnqgyy wseeevaeklrsvmvssfetiyqtaathkvdmrlaaymtgirksaeasrfrgwv
Timeline for d3k92c2: