Lineage for d3k8xc2 (3k8x C:1815-2193)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853345Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2853352Protein Acetyl-coenzyme A carboxylase, C-terminal domain [418957] (1 species)
    protein duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme
  7. 2853353Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419417] (8 PDB entries)
    Uniprot Q00955
  8. 2853356Domain d3k8xc2: 3k8x C:1815-2193 [212212]
    Other proteins in same PDB: d3k8xa1, d3k8xb1, d3k8xc1
    automated match to d1w2xa2
    complexed with b89

    has additional insertions and/or extensions that are not grouped together

Details for d3k8xc2

PDB Entry: 3k8x (more details), 2.3 Å

PDB Description: Crystal structure of the carboxyltransferase domain of acetyl-coenzyme A carboxylase in complex with tepraloxydim
PDB Compounds: (C:) acetyl-coa carboxylase

SCOPe Domain Sequences for d3k8xc2:

Sequence, based on SEQRES records: (download)

>d3k8xc2 c.14.1.4 (C:1815-2193) Acetyl-coenzyme A carboxylase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlddkyrel
rsqlsnkslapevhqqiskqladrerellpiygqislqfadlhdrssrmvakgviskele
wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
ieenyktlddklkglkles

Sequence, based on observed residues (ATOM records): (download)

>d3k8xc2 c.14.1.4 (C:1815-2193) Acetyl-coenzyme A carboxylase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlddkyrel
lpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlshq
vgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglkles

SCOPe Domain Coordinates for d3k8xc2:

Click to download the PDB-style file with coordinates for d3k8xc2.
(The format of our PDB-style files is described here.)

Timeline for d3k8xc2: