Lineage for d1d5bb2 (1d5b B:114-214)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289104Species Human (Homo sapiens) [TaxId:9606] [88575] (63 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 289172Domain d1d5bb2: 1d5b B:114-214 [21221]
    Other proteins in same PDB: d1d5ba1, d1d5ba2, d1d5bb1, d1d5bh1, d1d5bl1, d1d5bl2
    part of humanized oxy-cope catalytic Fab az-28

Details for d1d5bb2

PDB Entry: 1d5b (more details), 2.8 Å

PDB Description: unliganded mature oxy-cope catalytic antibody

SCOP Domain Sequences for d1d5bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5bb2 b.1.1.2 (B:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOP Domain Coordinates for d1d5bb2:

Click to download the PDB-style file with coordinates for d1d5bb2.
(The format of our PDB-style files is described here.)

Timeline for d1d5bb2: