Lineage for d1d5bb2 (1d5b B:114-214)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221908Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [49053] (4 PDB entries)
  8. 221918Domain d1d5bb2: 1d5b B:114-214 [21221]
    Other proteins in same PDB: d1d5ba1, d1d5bb1, d1d5bh1, d1d5bl1

Details for d1d5bb2

PDB Entry: 1d5b (more details), 2.8 Å

PDB Description: unliganded mature oxy-cope catalytic antibody
PDB Compounds: (B:)

SCOP Domain Sequences for d1d5bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5bb2 b.1.1.2 (B:114-214) Immunoglobulin (constant domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOP Domain Coordinates for d1d5bb2:

Click to download the PDB-style file with coordinates for d1d5bb2.
(The format of our PDB-style files is described here.)

Timeline for d1d5bb2: