| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
| Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
| Protein Acetyl-coenzyme A carboxylase, N-terminal domain [418956] (1 species) protein duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419416] (8 PDB entries) Uniprot Q00955 |
| Domain d3k8xb1: 3k8x B:1480-1814 [212209] Other proteins in same PDB: d3k8xa2, d3k8xb2, d3k8xc2 automated match to d1w2xa1 complexed with b89 |
PDB Entry: 3k8x (more details), 2.3 Å
SCOPe Domain Sequences for d3k8xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k8xb1 c.14.1.4 (B:1480-1814) Acetyl-coenzyme A carboxylase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffis
neliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpq
edeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylylt
segmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsray
hdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlgg
tqimynngvshltavddlagvekivewmsyvpakr
Timeline for d3k8xb1:
View in 3DDomains from other chains: (mouse over for more information) d3k8xa1, d3k8xa2, d3k8xc1, d3k8xc2 |