SCOP 1.73: Domain d1d5ba2: 1d5b A:108-211

Lineage for d1d5ba2 (1d5b A:108-211)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Domain d1d5ba2: 1d5b A:108-211 [21220]
Other proteins in same PDB: d1d5ba1, d1d5bb1, d1d5bb2, d1d5bh1, d1d5bh2, d1d5bl1
part of humanized oxy-cope catalytic Fab az-28

Details for d1d5ba2

PDB Entry: 1d5b (more details), 2.8 Å

PDB Description: unliganded mature oxy-cope catalytic antibody

PDB Compounds: (A:) chimeric OXY-COPE catalytic ANTIBODY AZ-28 (light chain)

SCOP Domain Sequences for d1d5ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5ba2 b.1.1.2 (A:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOP Domain Coordinates for d1d5ba2:

Click to download the PDB-style file with coordinates for d1d5ba2.
(The format of our PDB-style files is described here.)

Timeline for d1d5ba2: