Lineage for d1d5ba2 (1d5b A:108-211)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453918Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 453919Species Human (Homo sapiens) [TaxId:9606] [88569] (78 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 454011Domain d1d5ba2: 1d5b A:108-211 [21220]
    Other proteins in same PDB: d1d5ba1, d1d5bb1, d1d5bb2, d1d5bh1, d1d5bh2, d1d5bl1
    part of humanized oxy-cope catalytic Fab az-28

Details for d1d5ba2

PDB Entry: 1d5b (more details), 2.8 Å

PDB Description: unliganded mature oxy-cope catalytic antibody

SCOP Domain Sequences for d1d5ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5ba2 b.1.1.2 (A:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOP Domain Coordinates for d1d5ba2:

Click to download the PDB-style file with coordinates for d1d5ba2.
(The format of our PDB-style files is described here.)

Timeline for d1d5ba2: