SCOP 1.55: Domain d1d5ba2: 1d5b A:108-211

Lineage for d1d5ba2 (1d5b A:108-211)

Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [49053] (4 PDB entries)
Domain d1d5ba2: 1d5b A:108-211 [21220]
Other proteins in same PDB: d1d5ba1, d1d5bb1, d1d5bh1, d1d5bl1

Details for d1d5ba2

PDB Entry: 1d5b (more details), 2.8 Å

PDB Description: unliganded mature oxy-cope catalytic antibody

SCOP Domain Sequences for d1d5ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5ba2 b.1.1.2 (A:108-211) Immunoglobulin (constant domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOP Domain Coordinates for d1d5ba2:

Click to download the PDB-style file with coordinates for d1d5ba2.
(The format of our PDB-style files is described here.)

Timeline for d1d5ba2: