Lineage for d3k6mb1 (3k6m B:1-246)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2151006Family c.124.1.2: CoA transferase alpha subunit-like [74656] (7 protein domains)
    parallel beta-sheet of 7 strands, order 4321567
  6. 2151041Protein Succinate:CoA transferase, N-terminal domain [82464] (2 species)
  7. 2151047Species Pig (Sus scrofa) [TaxId:9823] [82465] (8 PDB entries)
  8. 2151049Domain d3k6mb1: 3k6m B:1-246 [212188]
    Other proteins in same PDB: d3k6ma2, d3k6mb2, d3k6mc2, d3k6md2
    automated match to d1o9la1
    complexed with cl, gol

Details for d3k6mb1

PDB Entry: 3k6m (more details), 1.5 Å

PDB Description: Dynamic domains of Succinyl-CoA:3-ketoacid-coenzyme A transferase from pig heart.
PDB Compounds: (B:) Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial

SCOPe Domain Sequences for d3k6mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k6mb1 c.124.1.2 (B:1-246) Succinate:CoA transferase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
erlsvr

SCOPe Domain Coordinates for d3k6mb1:

Click to download the PDB-style file with coordinates for d3k6mb1.
(The format of our PDB-style files is described here.)

Timeline for d3k6mb1: