![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.3: CoA transferase beta subunit-like [74657] (4 proteins) catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest |
![]() | Protein Succinate:CoA transferase, C-terminal domain [82466] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [82467] (8 PDB entries) |
![]() | Domain d3k6ma2: 3k6m A:262-480 [212187] Other proteins in same PDB: d3k6ma1, d3k6mb1, d3k6mc1, d3k6md1 automated match to d1ooyb1 complexed with cl, gol |
PDB Entry: 3k6m (more details), 1.5 Å
SCOPe Domain Sequences for d3k6ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k6ma2 c.124.1.3 (A:262-480) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} vreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqnevd adlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgklv kgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvdr kkgltlielwegltvddikkstgcdfavspklipmqqvt
Timeline for d3k6ma2: