| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
| Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
| Protein automated matches [190458] (4 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [196808] (4 PDB entries) |
| Domain d3k6ia1: 3k6i A:2-99 [212185] Other proteins in same PDB: d3k6ia2 automated match to d2omvb_ complexed with zn |
PDB Entry: 3k6i (more details), 1.13 Å
SCOPe Domain Sequences for d3k6ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k6ia1 b.1.6.0 (A:2-99) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ilatpilipenqrppfprsvgkvirsegtegakfrlsgkgvdqdpkgifrineisgdvsv
trpldreaianyelevevtdlsgkiidgpvrldisvid
Timeline for d3k6ia1: