SCOPe 2.08: Domain d3k6ia1: 3k6i A:2-99

Lineage for d3k6ia1 (3k6i A:2-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [196808] (4 PDB entries)

8. Domain d3k6ia1: 3k6i A:2-99 [212185]
   Other proteins in same PDB: d3k6ia2
   automated match to d2omvb_
   complexed with zn

Details for d3k6ia1

PDB Entry: 3k6i, 1.13 Å

PDB Description: Crystal structure of chicken T-cadherin EC1

PDB Compounds: (A:) T-cadherin

SCOPe Domain Sequences for d3k6ia1:

Sequence; same for both SEQRES and ATOM records:

>d3k6ia1 b.1.6.0 (A:2-99) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ilatpilipenqrppfprsvgkvirsegtegakfrlsgkgvdqdpkgifrineisgdvsv
trpldreaianyelevevtdlsgkiidgpvrldisvid

Timeline for d3k6ia1:

• d3k6ia1 first appeared in SCOPe 2.03, called d3k6ia_
  
• d3k6ia1 appears in SCOPe 2.07