Lineage for d3k6fa_ (3k6f A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1298299Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1298382Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 1298383Protein automated matches [190458] (3 species)
    not a true protein
  7. 1298398Species Mouse (Mus musculus) [TaxId:10090] [187373] (6 PDB entries)
  8. 1298399Domain d3k6fa_: 3k6f A: [212183]
    automated match to d1ncia_

Details for d3k6fa_

PDB Entry: 3k6f (more details), 1.81 Å

PDB Description: Crystal structure of mouse T-cadherin EC1
PDB Compounds: (A:) T-cadherin

SCOPe Domain Sequences for d3k6fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k6fa_ b.1.6.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sgivvspilipenqrqpfprdvgkvvdsdrpegskfrltgkgvdqdpkgtfrinentgsv
svtrtldretiatyqlyvettdasgktlegpvplevivid

SCOPe Domain Coordinates for d3k6fa_:

Click to download the PDB-style file with coordinates for d3k6fa_.
(The format of our PDB-style files is described here.)

Timeline for d3k6fa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3k6fb_