![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
![]() | Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
![]() | Protein automated matches [190458] (4 species) not a true protein |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [225845] (1 PDB entry) |
![]() | Domain d3k6da1: 3k6d A:2-99 [212182] Other proteins in same PDB: d3k6da2 automated match to d2omvb_ complexed with zn |
PDB Entry: 3k6d (more details), 1.8 Å
SCOPe Domain Sequences for d3k6da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k6da1 b.1.6.0 (A:2-99) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} ivapsisipenqripfpkivgrvvvsdripgskiklygkgvdqepkgifkinensgevsv tkaldreaipsyqlqvettdengktiegpvdleilvid
Timeline for d3k6da1: