SCOPe 2.08: Domain d3k6da1: 3k6d A:2-99

Lineage for d3k6da1 (3k6d A:2-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (4 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [225845] (1 PDB entry)

8. Domain d3k6da1: 3k6d A:2-99 [212182]
   Other proteins in same PDB: d3k6da2
   automated match to d2omvb_
   complexed with zn

Details for d3k6da1

PDB Entry: 3k6d, 1.8 Å

PDB Description: Crystal structure of Xenopus laevis T-cadherin EC1

PDB Compounds: (A:) T-cadherin

SCOPe Domain Sequences for d3k6da1:

Sequence; same for both SEQRES and ATOM records:

>d3k6da1 b.1.6.0 (A:2-99) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ivapsisipenqripfpkivgrvvvsdripgskiklygkgvdqepkgifkinensgevsv
tkaldreaipsyqlqvettdengktiegpvdleilvid

Timeline for d3k6da1:

• d3k6da1 first appeared in SCOPe 2.03, called d3k6da_
  
• d3k6da1 appears in SCOPe 2.07