![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
![]() | Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [49053] (4 PDB entries) |
![]() | Domain d1d5bl2: 1d5b L:108-211 [21218] Other proteins in same PDB: d1d5ba1, d1d5bb1, d1d5bh1, d1d5bl1 |
PDB Entry: 1d5b (more details), 2.8 Å
SCOP Domain Sequences for d1d5bl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5bl2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d1d5bl2: