SCOPe 2.05: Domain d3k5sa2: 3k5s A:101-217

Lineage for d3k5sa2 (3k5s A:101-217)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [196808] (4 PDB entries)

8. Domain d3k5sa2: 3k5s A:101-217 [212179]
   automated match to d1ncja2
   complexed with ca

Details for d3k5sa2

PDB Entry: 3k5s, 2.9 Å

PDB Description: Crystal structure of chicken T-cadherin EC1 EC2

PDB Compounds: (A:) cadherin-13

SCOPe Domain Sequences for d3k5sa2:

Sequence; same for both SEQRES and ATOM records:

>d3k5sa2 b.1.6.0 (A:101-217) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ndnrpmfkegpyvghvmegsptgttvmrmtafdaddpstdnallrynilkqtptkpspnm
fyidpekgdivtvvspvlldretmetpkyelvieakdmgghdvgltgtatatilidd

Timeline for d3k5sa2:

• d3k5sa2 first appeared in SCOPe 2.03
  
• d3k5sa2 appears in SCOPe 2.04
  
• d3k5sa2 appears in SCOPe 2.06
  
• d3k5sa2 appears in the current release, SCOPe 2.08