![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
![]() | Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
![]() | Protein automated matches [190458] (4 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [196808] (4 PDB entries) |
![]() | Domain d3k5sa2: 3k5s A:101-217 [212179] Other proteins in same PDB: d3k5sa3, d3k5sb3 automated match to d1ncja2 complexed with ca |
PDB Entry: 3k5s (more details), 2.9 Å
SCOPe Domain Sequences for d3k5sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k5sa2 b.1.6.0 (A:101-217) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} ndnrpmfkegpyvghvmegsptgttvmrmtafdaddpstdnallrynilkqtptkpspnm fyidpekgdivtvvspvlldretmetpkyelvieakdmgghdvgltgtatatilidd
Timeline for d3k5sa2: