Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (3 families) |
Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
Protein automated matches [190458] (3 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [196808] (4 PDB entries) |
Domain d3k5sa1: 3k5s A:1-100 [212178] automated match to d1ncja1 complexed with ca |
PDB Entry: 3k5s (more details), 2.9 Å
SCOPe Domain Sequences for d3k5sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k5sa1 b.1.6.0 (A:1-100) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} silatpilipenqrppfprsvgkvirsegtegakfrlsgkgvdqdpkgifrineisgdvs vtrpldreaianyqlevevtdlsgkiidgpvrldisvidq
Timeline for d3k5sa1: