Lineage for d3k5sa1 (3k5s A:2-100)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2360460Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2360564Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 2360565Protein automated matches [190458] (4 species)
    not a true protein
  7. 2360568Species Chicken (Gallus gallus) [TaxId:9031] [196808] (4 PDB entries)
  8. 2360576Domain d3k5sa1: 3k5s A:2-100 [212178]
    Other proteins in same PDB: d3k5sa3, d3k5sb3
    automated match to d1ncja1
    complexed with ca

Details for d3k5sa1

PDB Entry: 3k5s (more details), 2.9 Å

PDB Description: Crystal structure of chicken T-cadherin EC1 EC2
PDB Compounds: (A:) cadherin-13

SCOPe Domain Sequences for d3k5sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k5sa1 b.1.6.0 (A:2-100) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ilatpilipenqrppfprsvgkvirsegtegakfrlsgkgvdqdpkgifrineisgdvsv
trpldreaianyqlevevtdlsgkiidgpvrldisvidq

SCOPe Domain Coordinates for d3k5sa1:

Click to download the PDB-style file with coordinates for d3k5sa1.
(The format of our PDB-style files is described here.)

Timeline for d3k5sa1: