SCOPe 2.06: Domain d3k5rb2: 3k5r B:101-217

Lineage for d3k5rb2 (3k5r B:101-217)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187373] (7 PDB entries)

8. Domain d3k5rb2: 3k5r B:101-217 [212177]
   Other proteins in same PDB: d3k5ra3, d3k5rb3
   automated match to d1ncja2

Details for d3k5rb2

PDB Entry: 3k5r, 2 Å

PDB Description: Crystal Structure of mouse T-cadherin EC1 EC2

PDB Compounds: (B:) Cadherin 13

SCOPe Domain Sequences for d3k5rb2:

Sequence; same for both SEQRES and ATOM records:

>d3k5rb2 b.1.6.0 (B:101-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpifregpyighvmegsptgttvmrmtafdaddpatdnallrynirqqtpdkpspnm
fyidpekgdivtvvspalldretlenpkyeliieaqdmagldvgltgtatatividd

Timeline for d3k5rb2:

• d3k5rb2 first appeared in SCOPe 2.03
  
• d3k5rb2 appears in SCOPe 2.05
  
• d3k5rb2 appears in SCOPe 2.07
  
• d3k5rb2 appears in the current release, SCOPe 2.08