Lineage for d3k5ra2 (3k5r A:101-217)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768942Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1769032Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 1769033Protein automated matches [190458] (4 species)
    not a true protein
  7. 1769053Species Mouse (Mus musculus) [TaxId:10090] [187373] (6 PDB entries)
  8. 1769057Domain d3k5ra2: 3k5r A:101-217 [212175]
    automated match to d1ncja2

Details for d3k5ra2

PDB Entry: 3k5r (more details), 2 Å

PDB Description: Crystal Structure of mouse T-cadherin EC1 EC2
PDB Compounds: (A:) Cadherin 13

SCOPe Domain Sequences for d3k5ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k5ra2 b.1.6.0 (A:101-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpifregpyighvmegsptgttvmrmtafdaddpatdnallrynirqqtpdkpspnm
fyidpekgdivtvvspalldretlenpkyeliieaqdmagldvgltgtatatividd

SCOPe Domain Coordinates for d3k5ra2:

Click to download the PDB-style file with coordinates for d3k5ra2.
(The format of our PDB-style files is described here.)

Timeline for d3k5ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3k5ra1