![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
![]() | Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
![]() | Protein automated matches [190458] (4 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187373] (16 PDB entries) |
![]() | Domain d3k5ra1: 3k5r A:2-100 [212174] Other proteins in same PDB: d3k5ra3, d3k5rb3 automated match to d1ncja1 |
PDB Entry: 3k5r (more details), 2 Å
SCOPe Domain Sequences for d3k5ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k5ra1 b.1.6.0 (A:2-100) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ivvspilipenqrqpfprdvgkvvdsdrpegskfrltgkgvdqdpkgtfrinentgsvsv trtldretiatyqlyvettdasgktlegpvplevividq
Timeline for d3k5ra1: