SCOPe 2.08: Domain d3k5ra1: 3k5r A:2-100

Lineage for d3k5ra1 (3k5r A:2-100)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187373] (16 PDB entries)

8. Domain d3k5ra1: 3k5r A:2-100 [212174]
   Other proteins in same PDB: d3k5ra3, d3k5rb3
   automated match to d1ncja1

Details for d3k5ra1

PDB Entry: 3k5r, 2 Å

PDB Description: Crystal Structure of mouse T-cadherin EC1 EC2

PDB Compounds: (A:) Cadherin 13

SCOPe Domain Sequences for d3k5ra1:

Sequence; same for both SEQRES and ATOM records:

>d3k5ra1 b.1.6.0 (A:2-100) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivvspilipenqrqpfprdvgkvvdsdrpegskfrltgkgvdqdpkgtfrinentgsvsv
trtldretiatyqlyvettdasgktlegpvplevividq

Timeline for d3k5ra1:

• d3k5ra1 first appeared in SCOPe 2.03
  
• d3k5ra1 appears in SCOPe 2.07