SCOP 1.67: Domain d1axsb2: 1axs B:114-214

Lineage for d1axsb2 (1axs B:114-214)

Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Domain d1axsb2: 1axs B:114-214 [21217]
Other proteins in same PDB: d1axsa1, d1axsa2, d1axsb1, d1axsh1, d1axsl1, d1axsl2
part of humanized oxy-cope catalytic Fab az-28
complexed with cd, hop

Details for d1axsb2

PDB Entry: 1axs (more details), 2.6 Å

PDB Description: mature oxy-cope catalytic antibody with hapten

SCOP Domain Sequences for d1axsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axsb2 b.1.1.2 (B:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOP Domain Coordinates for d1axsb2:

Click to download the PDB-style file with coordinates for d1axsb2.
(The format of our PDB-style files is described here.)

Timeline for d1axsb2: