Lineage for d3k5la2 (3k5l A:390-778)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1692262Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1692263Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1692264Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 1692551Protein automated matches [226972] (8 species)
    not a true protein
  7. 1692555Species Escherichia coli [TaxId:562] [225831] (3 PDB entries)
  8. 1692557Domain d3k5la2: 3k5l A:390-778 [212167]
    Other proteins in same PDB: d3k5la1
    automated match to d1q8ia2
    protein/DNA complex; complexed with dtp, mg

Details for d3k5la2

PDB Entry: 3k5l (more details), 2.7 Å

PDB Description: crystal structure of e.coli pol ii-abasic dna-datp lt(0, 3) ternary complex
PDB Compounds: (A:) DNA polymerase II

SCOPe Domain Sequences for d3k5la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k5la2 e.8.1.1 (A:390-778) automated matches {Escherichia coli [TaxId: 562]}
nlgevpphaspggyvmdsrpglydsvlvldykslypsiirtflidpvglvegmaqpdpeh
stegfldawfsrekhclpeivtniwhgrdeakrqgnkplsqalkiimnafygvlgttacr
ffdprlassitmrghqimrqtkalieaqgydviygdtdstfvwlkgahseeeaakigral
vqhvnawwaetlqkqrltsaleleyethfcrflmptirgadtgskkryagliqegdkqrm
vfkgletvrtdwtplaqqfqqelylrifrnepyqeyvretidklmageldarlvyrkrlr
rplseyqrnvpphvraarladeenqkrgrplqyqnrgtikyvwttngpepldyqrspldy
ehyltrqlqpvaegilpfiednfatlmtg

SCOPe Domain Coordinates for d3k5la2:

Click to download the PDB-style file with coordinates for d3k5la2.
(The format of our PDB-style files is described here.)

Timeline for d3k5la2: