Lineage for d3k5la1 (3k5l A:-2-389)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1607175Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1607536Protein automated matches [190162] (4 species)
    not a true protein
  7. 1607547Species Escherichia coli [TaxId:562] [187263] (13 PDB entries)
  8. 1607564Domain d3k5la1: 3k5l A:-2-389 [212166]
    Other proteins in same PDB: d3k5la2
    automated match to d1q8ia1
    protein/DNA complex; complexed with dtp, mg

Details for d3k5la1

PDB Entry: 3k5l (more details), 2.7 Å

PDB Description: crystal structure of e.coli pol ii-abasic dna-datp lt(0, 3) ternary complex
PDB Compounds: (A:) DNA polymerase II

SCOPe Domain Sequences for d3k5la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k5la1 c.55.3.5 (A:-2-389) automated matches {Escherichia coli [TaxId: 562]}
gphmaqagfiltrhwrdtpqgtevsfwlatdngplqvtlapqesvafipadqvpraqhil
qgeqgfrltplalkdfhrqpvyglycrahrqlmnyekrlreggvtvyeadvrpperylme
rfitspvwvegdmhngtivnarlkphpdyrpplkwvsidiettrhgelyciglegcgqri
vymlgpengdassldfeleyvasrpqlleklnawfanydpdviigwnvvqfdlrmlqkha
eryrlplrlgrdnselewrehgfkngvffaqakgrliidgiealksafwnfssfsletva
qellgegksidnpwdrmdeidrrfaedkpalatynlkncelvtqifhkteimpfllerat
vnglpvdrhggsvaafghlyfprmhragyvap

SCOPe Domain Coordinates for d3k5la1:

Click to download the PDB-style file with coordinates for d3k5la1.
(The format of our PDB-style files is described here.)

Timeline for d3k5la1: