Lineage for d3k51a_ (3k51 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777598Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2777599Protein automated matches [190873] (4 species)
    not a true protein
  7. 2777600Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)
  8. 2777653Domain d3k51a_: 3k51 A: [212165]
    automated match to d2re9a_

Details for d3k51a_

PDB Entry: 3k51 (more details), 2.45 Å

PDB Description: crystal structure of dcr3-tl1a complex
PDB Compounds: (A:) Tumor necrosis factor ligand superfamily member 15, secreted form

SCOPe Domain Sequences for d3k51a_:

Sequence, based on SEQRES records: (download)

>d3k51a_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdkprahltvvrqtptqhfknqfpalhwehelglaftknrmnytnkfllipesgdyfiys
qvtfrgmtsesseirqagrpnkpdsitvvitkvtdsypeptqllmgtksvsevgsnwfqp
iylgamfslqegdklmvnvsdislvdytkedktffgafll

Sequence, based on observed residues (ATOM records): (download)

>d3k51a_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdkprahltvvrqtptqhfknqfpalhwehelglaftknrmnytnkfllipesgdyfiys
qvtfrgmpdsitvvitkvtdsypeptqllmgtksvsgsnwfqpiylgamfslqegdklmv
nvsdislvdytkedktffgafll

SCOPe Domain Coordinates for d3k51a_:

Click to download the PDB-style file with coordinates for d3k51a_.
(The format of our PDB-style files is described here.)

Timeline for d3k51a_: