SCOPe 2.03: Domain d3k4hb_: 3k4h B:

Lineage for d3k4hb_ (3k4h B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (31 species)
   not a true protein

7. Species Bacillus cytotoxicus [TaxId:315749] [225781] (1 PDB entry)

8. Domain d3k4hb_: 3k4h B: [212164]
   automated match to d3hs3b_
   complexed with mal

Details for d3k4hb_

PDB Entry: 3k4h, 2.8 Å

PDB Description: crystal structure of putative transcriptional regulator laci from bacillus cereus subsp. cytotoxis nvh 391-98

PDB Compounds: (B:) Putative transcriptional regulator

SCOPe Domain Sequences for d3k4hb_:

Sequence; same for both SEQRES and ATOM records:

>d3k4hb_ c.93.1.0 (B:) automated matches {Bacillus cytotoxicus [TaxId: 315749]}
nqttktlglvmpssaskafqnpffpevirgissfahvegyalymstgeteeeifngvvkm
vqgrqiggiillysrendriiqylheqnfpfvligkpydrkdeityvdndnytaarevae
ylislghkqiafigggsdllvtrdrlagmsdalkladivlpkeyilhfdfsresgqqave
elmglqqpptaimatddliglgvlsalskkgfvvpkdvsivsfnnallseiaspplstvd
vniyqlgyeaakalvdkvenaestakciiiphkllkrq

Timeline for d3k4hb_:

• d3k4hb_ is new in SCOPe 2.03-stable
  
• d3k4hb_ appears in SCOPe 2.04
  
• d3k4hb_ appears in the current release, SCOPe 2.08