SCOPe 2.05: Domain d1axsa2: 1axs A:108-211

Lineage for d1axsa2 (1axs A:108-211)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1axsa2: 1axs A:108-211 [21216]
   Other proteins in same PDB: d1axsa1, d1axsb1, d1axsb2, d1axsh1, d1axsh2, d1axsl1
   part of humanized oxy-cope catalytic Fab az-28
   complexed with cd, hop

Details for d1axsa2

PDB Entry: 1axs, 2.6 Å

PDB Description: mature oxy-cope catalytic antibody with hapten

PDB Compounds: (A:) oxy-cope catalytic antibody

SCOPe Domain Sequences for d1axsa2:

Sequence; same for both SEQRES and ATOM records:

>d1axsa2 b.1.1.2 (A:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d1axsa2:

• d1axsa2 first appeared (with stable ids) in SCOP 1.55
  
• d1axsa2 appears in SCOPe 2.04
  
• d1axsa2 appears in SCOPe 2.06
  
• d1axsa2 appears in the current release, SCOPe 2.08