| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
| Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [49053] (4 PDB entries) |
| Domain d1axsa2: 1axs A:108-211 [21216] Other proteins in same PDB: d1axsa1, d1axsb1, d1axsh1, d1axsl1 |
PDB Entry: 1axs (more details), 2.6 Å
SCOP Domain Sequences for d1axsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1axsa2 b.1.1.2 (A:108-211) Immunoglobulin (constant domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d1axsa2: