Lineage for d3k2ja1 (3k2j A:356-462)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2707951Domain d3k2ja1: 3k2j A:356-462 [212155]
    Other proteins in same PDB: d3k2ja2, d3k2jb2
    automated match to d3gg3a_
    complexed with cl, so4

Details for d3k2ja1

PDB Entry: 3k2j (more details), 2.2 Å

PDB Description: Crystal Structure of the 3rd Bromodomain of Human Poly-bromodomain containing protein 1 (PB1)
PDB Compounds: (A:) Protein polybromo-1

SCOPe Domain Sequences for d3k2ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k2ja1 a.29.2.0 (A:356-462) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlydtvrscrnnqgqliaepfyhlpskkkypdyyqqikmpislqqirtklknqeyetldh
lecdlnlmfenakrynvpnsaiykrvlklqqvmqakkkelarrddie

SCOPe Domain Coordinates for d3k2ja1:

Click to download the PDB-style file with coordinates for d3k2ja1.
(The format of our PDB-style files is described here.)

Timeline for d3k2ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3k2ja2