Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.4: Dihydroorotase [63917] (2 proteins) |
Protein automated matches [191232] (2 species) not a true protein |
Species Salmonella enterica [TaxId:99287] [225762] (1 PDB entry) |
Domain d3jzeb_: 3jze B: [212147] automated match to d2z26a_ complexed with acy, bme, cl, pg4, pge, zn |
PDB Entry: 3jze (more details), 1.8 Å
SCOPe Domain Sequences for d3jzeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jzeb_ c.1.9.4 (B:) automated matches {Salmonella enterica [TaxId: 99287]} qvlkirrpddwhvhlrdgdmlktvvpytseiygraivmpnlaspittvdaaiayrqrild avpaghdftplmtcyltdsldadelergfhegvftaaklypanattnsshgvtsvdaimp vlermeklgipllvhgevthadvdifdrearfidtvmeplrqrltalkvvfehittkdaa qyvrdgndylaatitpqhlmfnrndmlvggirphlyclpilkrnihqqalrelvasgftr aflgtdsaphsrhrketscgcagcfnapsalgsyaavfeemnalahfeafcslngpqfyg lpmntgwvelvrdeqqipgnialaddslvpflagetvrwsvk
Timeline for d3jzeb_: