Lineage for d3jzeb_ (3jze B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833666Family c.1.9.4: Dihydroorotase [63917] (2 proteins)
  6. 2833695Protein automated matches [191232] (2 species)
    not a true protein
  7. 2833699Species Salmonella enterica [TaxId:99287] [225762] (1 PDB entry)
  8. 2833701Domain d3jzeb_: 3jze B: [212147]
    automated match to d2z26a_
    complexed with acy, bme, cl, pg4, pge, zn

Details for d3jzeb_

PDB Entry: 3jze (more details), 1.8 Å

PDB Description: 1.8 angstrom resolution crystal structure of dihydroorotase (pyrc) from salmonella enterica subsp. enterica serovar typhimurium str. lt2
PDB Compounds: (B:) dihydroorotase

SCOPe Domain Sequences for d3jzeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jzeb_ c.1.9.4 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
qvlkirrpddwhvhlrdgdmlktvvpytseiygraivmpnlaspittvdaaiayrqrild
avpaghdftplmtcyltdsldadelergfhegvftaaklypanattnsshgvtsvdaimp
vlermeklgipllvhgevthadvdifdrearfidtvmeplrqrltalkvvfehittkdaa
qyvrdgndylaatitpqhlmfnrndmlvggirphlyclpilkrnihqqalrelvasgftr
aflgtdsaphsrhrketscgcagcfnapsalgsyaavfeemnalahfeafcslngpqfyg
lpmntgwvelvrdeqqipgnialaddslvpflagetvrwsvk

SCOPe Domain Coordinates for d3jzeb_:

Click to download the PDB-style file with coordinates for d3jzeb_.
(The format of our PDB-style files is described here.)

Timeline for d3jzeb_: