Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (77 species) not a true protein |
Species Lactobacillus brevis [TaxId:387344] [225768] (1 PDB entry) |
Domain d3jy6d1: 3jy6 D:68-328 [212144] Other proteins in same PDB: d3jy6a2, d3jy6d2 automated match to d2nzug_ complexed with cl, edo |
PDB Entry: 3jy6 (more details), 1.97 Å
SCOPe Domain Sequences for d3jy6d1:
Sequence, based on SEQRES records: (download)
>d3jy6d1 c.93.1.0 (D:68-328) automated matches {Lactobacillus brevis [TaxId: 387344]} kliavivaniddyfstelfkgissilesrgyigvlfdanadierektllraigsrgfdgl ilqsfsnpqtvqeilhqqmpvvsvdremdacpwpqvvtdnfeaakaattafrqqgyqhvv vltselelsrtrqeryrgilaaaqdvdvlevsessynhsevhqrltqlitqndqktvafa lkerwlleffpnliisglidnqtvtatgfadtdfirrmepkltlitqnpflmgassaeim lrqlagekvapekmvipaklq
>d3jy6d1 c.93.1.0 (D:68-328) automated matches {Lactobacillus brevis [TaxId: 387344]} kliavivaniddyfstelfkgissilesrgyigvlfdanadierektllraigsrgfdgl ilqsfsnpqtvqeilhqqmpvvsvdremdacpwpqvvtdnfeaakaattafrqqgyqhvv vltselelsrtrqeryrgilaaaqdvdvlevsessyhsevhqrltqlitqndqktvafal kerwlleffpnliisglidnqtvtatgfadtdfirrmepkltlitqnpflmgassaeiml rqlagekvapekmvipaklq
Timeline for d3jy6d1:
View in 3D Domains from other chains: (mouse over for more information) d3jy6a1, d3jy6a2, d3jy6b_, d3jy6c_ |